Kapselmaschine Teemaschine silber, Multifunktionale Maschine für Tee und Kaffee , Kaffeemaschine, Padmaschine , Kaffeekapselmaschine, inkl. 36 Probe Kapseln / Kaffeepads – TEEKANNE “Lounge” Kaffee

TEEKANNE Lounge - Zusätzliche kapseln mit verschiedenen Geschmacksrichtungen finden Sie ebenfalls diesem Angebot. Probepackung mit 36 kapseln, zusätzliche Kapseln mit verschiedenen Geschmacksrichtungen finden Sie ebenfalls diesem Angebot. Einfach im drop-Down Menü auswählen. Die neuartige maschine des teekanne lounge systems wurde speziell von den Experten von Teekanne, K-fee und einem führenden Schweizer Maschinenhersteller für die Zubereitung von Kaffee und Tee entwickelt.

Perfekte temperatur: die sorten werden mit der jeweils idealen Temperatur aufgegossen Patentiertes Aufbrühsystem: Dank des Aufbrühsystems wird Ihr Heißgetränk in der Kapsel gezielt und kraftvoll umspült. Bei der kaffeekapsel ohne aromasiegel einfach die Kapsel einlegen und die weiße Taste auf dem Gerät betätigen.

Gefiltertes wasser: der integrierte Wasserfilter verringert den Kalkgehalt des Wassers und reduziert geschmacksstörende Stoffe für weiches Wasser und perfekten Genuss. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt.

Kapselmaschine Teemaschine silber, Multifunktionale Maschine für Tee und Kaffee , Kaffeemaschine, Padmaschine , Kaffeekapselmaschine, inkl. 36 Probe Kapseln / Kaffeepads - TEEKANNE "Lounge" Kaffee - Dadurch kann sich der geschmack schneller entfalten   einfache AnwendungDas Teekanne Lounge System besticht durch seine einfache Handhabung: Aromasiegel an der Teekapsel abziehen, Kapsel einlegen, Hebel nach unten und dann einfach die entsprechende Taste für das Expert Programm drücken. Einfach im drop-down menü auswählen technische details: farbe - silber artikelgewicht - 3, 7 cm   lieferumfang: kapselmaschinewasserfilterreinigungskapselstarterset 36 kapseln - 20x tee, 60 kgFassungsvermögen - 4 Tassen Leistung - 1455 Watt Pumpendruck - 19 barFüllmenge - 1 LProgramme - 4 Expert ProgrammeAbschaltautomatik - jaabnehmbarer Wassertank - jaReinigungsprogramm - jaBetriebskontrollleuchte - jaBetriebsart - NetzbetriebEingangsspannung - 220-240 VoltGehäuse - Kunststoff   Abmessungen: 20, 16x Kaffee Die neue kapselmaschine speziell für kaffee und tee entwickelt, 6 x 48, 5 x 37, inkl.

Praktische heißwasser-funktion - In 20 Sekunden betriebsbereit, energiesparend, verkürzte Ziehzeit, automatische Abschaltung.

Weitere Informationen über TEEKANNE Lounge

Extraktor 200 W, BPA-freie Zitruspresse, Slowjuicer 65 U/min, Vertikale Saftpresse für ganze Früchte und Gemüse, Spülmaschinengeeignet, rot - Saftpresse - VitaSpeed Multifunktions Entsafter

weg-ist-weg.com - Vitamine und Mineralstoffe bleiben erhalten. Bpa-freie materialien - alle teile edelstahlfilter, Silikon-Komponente, Pressschnecke und Saftschale sind aus Baby-Lebensmitteltauglichen BPA-freie Materialien gefertigt. Die schneckenpresse dreht sich bei 60 rpm und entnimmt bis zu 30% mehr saft und 40% mehr vitamine und mineralien als herkömmliche Entsafter.

Leichte reinigung - Die vertikale Obstpresse wurde nach dem Easy-Clean Konzept entworfen. Weniger oxidation bedeutet ein nährstoffreicherer Saft. Hierbei wird nicht nur schonend gepresst, sondern auch der Saft aus dem Fruchtfleisch extrahiert. Durch langsames zerdrücken der Zutaten anstatt durch Zerkleinern unter Hochgeschwindigkeit wird weniger Wärme erzeugt als bei herkömmlichen Entsaftern.

Extraktor 200 W, BPA-freie Zitruspresse, Slowjuicer 65 U/min, Vertikale Saftpresse für ganze Früchte und Gemüse, Spülmaschinengeeignet, rot - Saftpresse - VitaSpeed Multifunktions Entsafter - Entnimmt saft von allen frucht -und Gemüsesorten: weiche Früchte und weiches Gemüse, grünes Blattgemüse und Weizengras. Der küchenhelfer kann nicht nur saft und Smoothie pressen, Eis, auch Sorbet, Marmelade und sogar passierte Tomaten für Pizza sind im Nu zubereitet. Exklusiv auf amazon. De -zusammengestellt durch weg-ist-weg.

Genießen sie ganz einfach köstliche Säfte und gefrorene Kreationen wie Sorbets, Frozen Jogurt u. V. M.

Weitere Informationen über weg-ist-weg.com

Ähnliche Produkte

SAVOIE RG83N 2in1 Raclette-Grill/Steingrill für 8 Personen, Partygrill mit Natursteinplatte, zum Grillen und Überbacken Fleisch, Fisch, Gemüse, Grill Antihaftbeschichtet, 8 Pfännchen, starke 1200W

weg-ist-weg.com - 65 x 70 mm8 holzspatelnnaturgrillsteinGrillplatte   Zur erhaltung wertvoller vitamine, mineralstoffe und enzyme arbeitet der kaltentsafter mit langsameren Umdrehungen. Somit können die einzelteile der Presse mit der Reinigungsbürste oder in der Spülmaschine gereinigt werden. Savoie 2 in 1 raclette- grill grillen und genießen, mit dem eleganten und hochwertig verarbeiteten 2in1 Raclette-Grill von SAVOIE sind Ihrer Fantasie keine Grenzen gesetzt.

Entfernt automatisch saft vom trester- mithilfe des sicherheitsverschlusses mit tropfstoppfunktion kann eine große Bandbreite an verschiedenen Säften kreiert werden. Für gemütliche abende mit Familie und Freunden an Weinachten, Silvester oder zwischendurch. Einfache reinigung dank antihaftbeschichtung auf Pfannen und Grillplatte: Abwaschen mit Wasser, Trocknen mit Haushaltstuch - Inklusive 8 Raclettepfännchen und 8 Racletteschiebern aus Holz.

SAVOIE RG83N 2in1 Raclette-Grill/Steingrill für 8 Personen, Partygrill mit Natursteinplatte, zum Grillen und Überbacken Fleisch, Fisch, Gemüse, Grill Antihaftbeschichtet, 8 Pfännchen, starke 1200W - Das kompakte design ist platzsparend und passt somit in fast jeden Küchenschrank. Für weitere informationen zu diesem Produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt. 2011 des "etm Testmagazins". Preis-/ leistungstestsieger mit der note "gut" 85, 6 %, im Test: 13 Raclettes verschiedener Hersteller siehe Foto und Online Ausgabe Nov.

In unserem sortiment finden sie auch das SAVOIE RG839 Raclette für 4 Personen.

Weitere Informationen über weg-ist-weg.com

Ähnliche Produkte

PerfectCook Edelstahl Reiskocher Dampfgarer klein, 3in1 Gerät Reiskocher, Risottokocher, Gemüsegarer, Multikocher 1,2L, Risotto Topf, Dämpfeinsatz, Reistopf für alle Reisarten, inkl 1kg Reis

weg-ist-weg.com - In paella, beides gleichmäßig verteilen und einschalten. In unserem sortiment finden sie auch das SAVOIE RG839 Raclette für 4 Personen. 1, 5 x 23 x 22 lieferumfang: reiskocher1 kg reis in premium qualität dampfkorbeinsatz großer reislöffel mit griffprofil messbecher mit duo-skalierung wasser / reis bedienungsanleitung zur erhaltung wertvoller vitamine, 2 l wasser Fassungsvermögen Schüssel Mehl in g: - Spülmaschinengeeignet: alle Teile ausser Reiskocher Kabellänge m: 105 cm geeignet für 5 Tassen Dosier-Skala im Kochbehälter Sicherheits-Trockengehschutz: schaltet automatisch ab Abmessungen: Gerätemaße H/B/T cm: 22, Edelstahl, 5 kg Farbe: Edelstahl gebürstet / schwarz Material: Kunststoff, Aluminium Topf Leistung Watt: 400 W Warmhaltefunktion für bis zu 8 Stunden Fassungsvermögen Schüssel flüssig in Liter: 1, mineralstoffe und enzyme arbeitet der kaltentsafter mit langsameren Umdrehungen.

. Exklusiv auf amazon. De - zusammengestellt durch weg-ist-weg. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt. Für gemütliche abende mit Familie und Freunden an Weinachten, Silvester oder zwischendurch.

PerfectCook Edelstahl Reiskocher Dampfgarer klein, 3in1 Gerät Reiskocher, Risottokocher, Gemüsegarer, Multikocher 1,2L, Risotto Topf, Dämpfeinsatz, Reistopf für alle Reisarten, inkl 1kg Reis - Einfache reinigung dank antihaftbeschichtung auf Pfannen und Grillplatte: Abwaschen mit Wasser, Trocknen mit Haushaltstuch - Inklusive 8 Raclettepfännchen und 8 Racletteschiebern aus Holz. Somit können die einzelteile der Presse mit der Reinigungsbürste oder in der Spülmaschine gereinigt werden. Leistungsstarker Reiskocher mit Warmhaltefunktion für perfekt gegarten Reis.

Weitere Informationen über weg-ist-weg.com

Ähnliche Produkte

Früchtetee Sortiment mit 4 Sorten 32 Kapseln - Teekanne Tealounge Kapseln

Teekanne - Leichte reinigung - Die vertikale Obstpresse wurde nach dem Easy-Clean Konzept entworfen. Weniger oxidation bedeutet ein nährstoffreicherer Saft. Sortiment: wild berry, Sweet Apple, Orange Splash, Hot Love. Ideal für alle die Grünen Tee lieben. Leistungsstarker Reiskocher mit Warmhaltefunktion für perfekt gegarten Reis.

Vitamine und Mineralstoffe bleiben erhalten. Bpa-freie materialien - alle teile edelstahlfilter, Silikon-Komponente, Pressschnecke und Saftschale sind aus Baby-Lebensmitteltauglichen BPA-freie Materialien gefertigt. Die schneckenpresse dreht sich bei 60 rpm und entnimmt bis zu 30% mehr saft und 40% mehr vitamine und mineralien als herkömmliche Entsafter.

Tealounge früchtetee sortiment wild berry - zutaten: hibiskus 43 %, süßholz, himbeeren, Waldfruchtaroma 6 %, Brombeeren, natürliches Aroma, Erdbeeren, Äpfel 24 %, süße Brombeerblätter 11 %, schwarze Johannisbeeren. Mit flexibler temperaturregelung, rutschfesten Füßen und 80 cm Netzkabel. Entfernt automatisch saft vom trester- mithilfe des sicherheitsverschlusses mit tropfstoppfunktion kann eine große Bandbreite an verschiedenen Säften kreiert werden.

Früchtetee Sortiment mit 4 Sorten 32 Kapseln - Teekanne Tealounge Kapseln - 4 packung mit je 8 kapseln gesamtfüllgewicht 57, 6g Zur erhaltung wertvoller vitamine, mineralstoffe und enzyme arbeitet der kaltentsafter mit langsameren Umdrehungen. 4 sorten à 8 kapseln 32 Kapseln. Somit können die einzelteile der Presse mit der Reinigungsbürste oder in der Spülmaschine gereinigt werden.

Weitere Informationen über Teekanne

Ähnliche Produkte

Teekanne Tealounge Kapseln 25 Sorten Probiermix - 25 unterschiedliche Tees aus aller Welt insgesamt 25 Teekapseln

Teekanne - Orange Splash No. Hot love No. Deluxe-reiskocher, risotto-maker und gemüse-steamer 3 in 1: traditioneller asiatischer meister-reiskocher für alle Reisarten geeignet inklusive Thai Duftreis und indischer Basmati-Reis - zum kochen, dünsten und warmhalten. Preis-/ leistungstestsieger mit der Note 1, 5 gut, im Test: diverse Reiskocher verschiedener Hersteller siehe Foto.

Preis-/ leistungstestsieger mit der note "gut" 85, 6 %, im Test: 13 Raclettes verschiedener Hersteller siehe Foto und Online Ausgabe Nov. 651: melisse, orangenblätter, honeybush, hopfen, Zitronenmyrte, Pfefferminze, Süßholz, Süße Brombeerblätter, Lavendel 14. Und das ganz von alleine! ist der Reis fertig, schaltet der Kocher automatisch in den Warmhaltemodus! Das ist zeitsparend und einfach praktisch.

Teekanne Tealounge Kapseln 25 Sorten Probiermix - 25 unterschiedliche Tees aus aller Welt insgesamt 25 Teekapseln - Exklusiv auf amazon. De -zusammengestellt durch weg-ist-weg. Chai Classic No. Somit können die einzelteile der Presse mit der Reinigungsbürste oder in der Spülmaschine gereinigt werden. Hierbei wird nicht nur schonend gepresst, sondern auch der Saft aus dem Fruchtfleisch extrahiert. Durch langsames zerdrücken der Zutaten anstatt durch Zerkleinern unter Hochgeschwindigkeit wird weniger Wärme erzeugt als bei herkömmlichen Entsaftern.

Legend 1882 No. 15.

Weitere Informationen über Teekanne

Ähnliche Produkte

Spülmaschinentabs 14in1-10 kg / 500 Stück Spültabs in Abziehfolie, A-Ware Tabs aus deutscher Herstellung, für jede Spülmaschine geeignet

weg-ist-weg - Exklusiv auf amazon. De -zusammengestellt durch weg-ist-weg. Vitamine und Mineralstoffe bleiben erhalten. Bpa-freie materialien - alle teile edelstahlfilter, Silikon-Komponente, Pressschnecke und Saftschale sind aus Baby-Lebensmitteltauglichen BPA-freie Materialien gefertigt. Die schneckenpresse dreht sich bei 60 rpm und entnimmt bis zu 30% mehr saft und 40% mehr vitamine und mineralien als herkömmliche Entsafter.

Hermetisch verschlossene Teekapseln sorgen für Erhaltung der Aromen - Ihr Lieblingstee per Knopfdruck. Die farben der tabs können von der Abbildung abweichen, was natürlich keinerlei Auswirkung auf die Qualität der Tabs hat. Leistungsstarker Reiskocher mit Warmhaltefunktion für perfekt gegarten Reis.

Spülmaschinentabs 14in1-10 kg / 500 Stück Spültabs in Abziehfolie, A-Ware Tabs aus deutscher Herstellung, für jede Spülmaschine geeignet - Glasschutz: der integrierte Glasschutz hilft dauerhafte Glaskorrision zu minimieren, damit Gläser dauerhaft strahlen. 8. Qualitätsware des führenden deutschen Herstellers, der auch unter namhaften anderen deutschen Marken vertrieben wird, bei diesem Angebot jedoch zu einem günstigeren Preis. Entfernt automatisch saft vom trester- mithilfe des sicherheitsverschlusses mit tropfstoppfunktion kann eine große Bandbreite an verschiedenen Säften kreiert werden.

Tee-kapseln für Teekanne Tealounge System K-Fee. In unserem sortiment finden sie auch das SAVOIE RG839 Raclette für 4 Personen.

Weitere Informationen über weg-ist-weg

Ähnliche Produkte

ThermaRelaxx 2in1 Fusswärmer mit Massagefunktion, Heizkissen mit weichem Teddyfutter, Wärmetherapie Kissen Innenfutter 30 C° Maschinenwäsche geeignet, bis Gr. 46, Abschaltautomatik, weiss

weg-ist-weg.com - Das kompakte design ist platzsparend und passt somit in fast jeden Küchenschrank. Jeder Tab ist einzeln verpackt. Dies setzt voraus, dass sie sich stets auf Ihre Gesundheit konzentrieren – und nicht auf das Gerät. 35 °caufwärmzeit nur 3 - 5 minuten für spannungen zwischen 110 v und 240 v geeignet auch auf der reise einsetzbar  großflächiges, dickes bodenpolster: kaum Wärmeverlust; auch bei kalten Bödenangenehmes Auflagegefühl für die Füßeherausnehmbar; leichte Oberflächenreinigung  Komfort-Innenfutter Schafwolle-Imitat „Teddy“: voll ausgekleideter Innenraumherausnehmbar und waschbar  Wärme und Massage getrennt und parallel einsetzbarergonomisches Handbedienteil Kabelfernbedienung für alle Bedienmöglichkeiten Hoher Schaft ca.

Schnellaufheizung von 3 min. Extra langes kabel ca. Und das ganz von alleine! ist der Reis fertig, schaltet der Kocher automatisch in den Warmhaltemodus! Das ist zeitsparend und einfach praktisch. Exklusiv auf amazon. De -zusammengestellt durch weg-ist-weg. Hierbei wird nicht nur schonend gepresst, sondern auch der Saft aus dem Fruchtfleisch extrahiert.

ThermaRelaxx 2in1 Fusswärmer mit Massagefunktion, Heizkissen mit weichem Teddyfutter, Wärmetherapie Kissen Innenfutter 30 C° Maschinenwäsche geeignet, bis Gr. 46, Abschaltautomatik, weiss - Durch langsames zerdrücken der Zutaten anstatt durch Zerkleinern unter Hochgeschwindigkeit wird weniger Wärme erzeugt als bei herkömmlichen Entsaftern. Berzeugen sie sich von der hohen Qualität dieser Tabs. Die farben der tabs können von der Abbildung abweichen, was natürlich keinerlei Auswirkung auf die Qualität der Tabs hat.

Weitere Informationen über weg-ist-weg.com

Ähnliche Produkte

Kräutertee Sortiment mit 5 Sorten 40 Kapseln - Teekanne Tealounge Kapseln

Teekanne - Weniger oxidation bedeutet ein nährstoffreicherer Saft. Das kompakte design ist platzsparend und passt somit in fast jeden Küchenschrank. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt.

Tee-kapseln für Teekanne Tealounge System K-Fee. Wir versenden ausschließlich in doppelwelligen Kartons so das der sichere Transport gewährleistet ist. Hochwertiger doppelt antihaftbeschichteter Innentopf. Mit flexibler temperaturregelung, rutschfesten Füßen und 80 cm Netzkabel. Sortiment: mint experience, Camomile Garden, Fennel Anis Duo, mountain Harmony, Ginger Sprizz.

Kräutertee Sortiment mit 5 Sorten 40 Kapseln - Teekanne Tealounge Kapseln - Ausgewogene und erlesene Kräutermischungen. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt. Schnellaufheizung von 3 min. Extra langes kabel ca. Dies wurde in langwierigen Tests festgestellt.

Weitere vorteile: - geeignet für alle spülmaschinen - hochwertige qualität - ideal für Großverbraucher - effizient, schon bei geringer Temperatur - Gewicht je Tab : 20gr. Wir verwenden füllmaterial für die Dämmung Ihrer Tabs.

Weitere Informationen über Teekanne

Ähnliche Produkte

TEEKANNE TEALOUNGE System Henkel, 6er Set Teegläser, Glas, transparent, 8 x 11.5 x 11 cm, 6-Einheiten

Teekanne GmbH & Co. KG 1262 - Exklusiv auf amazon. De - zusammengestellt durch weg-ist-weg. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt. Deluxe-reiskocher, risotto-maker und gemüse-steamer 3 in 1: traditioneller asiatischer meister-reiskocher für alle Reisarten geeignet inklusive Thai Duftreis und indischer Basmati-Reis - zum kochen, dünsten und warmhalten.

Das kompakte design ist platzsparend und passt somit in fast jeden Küchenschrank. 5 sorten à 8 kapseln 40 Kapseln. Schauen sie sich auch unsere anderen Thermarelaxx Wärmetherapie-Produkte an und sparen Sie beim Kombikauf. Für gemütliche abende mit Familie und Freunden an Weinachten, Silvester oder zwischendurch.

TEEKANNE TEALOUNGE System Henkel, 6er Set Teegläser, Glas, transparent, 8 x 11.5 x 11 cm, 6-Einheiten - Einfache reinigung dank antihaftbeschichtung auf Pfannen und Grillplatte: Abwaschen mit Wasser, Trocknen mit Haushaltstuch - Inklusive 8 Raclettepfännchen und 8 Racletteschiebern aus Holz. Leichte reinigung - Die vertikale Obstpresse wurde nach dem Easy-Clean Konzept entworfen. Aus kuscheligem Teddy Fleece.

Hermetisch verschlossene Teekapseln sorgen für Erhaltung der Aromen - Ihr Lieblingstee per Knopfdruck. Sortiment: mint experience, Fennel Anis Duo, mountain Harmony, Camomile Garden, Ginger Sprizz. Ausgewogene und erlesene Kräutermischungen.

Weitere Informationen über Teekanne GmbH & Co. KG 1262

Ähnliche Produkte

Teegläser mit Henkel 2er Set - 230 ml Teeglas aus Glas, Transparent von Teekanne

Teekanne Tealounge - Für weitere informationen zu diesem Produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt. QualitÄt: hitzebeständige Trinkgläser aus Glas, Spülmaschinenfest und mikrowellenfest. Für weitere informationen zum produkt, lesen Sie bitte weiter unten auf dieser Seite nach oder schauen Sie unter den Kundenrezensionen oder Kundenfragen zum Produkt.

Innenfutter herausnehmbar und waschbar. In unserem sortiment finden sie auch das SAVOIE RG839 Raclette für 4 Personen. Und das ganz von alleine! ist der Reis fertig, schaltet der Kocher automatisch in den Warmhaltemodus! Das ist zeitsparend und einfach praktisch. Exklusiv auf amazon. De -zusammengestellt durch weg-ist-weg.

Teegläser mit Henkel 2er Set - 230 ml Teeglas aus Glas, Transparent von Teekanne - Schnellaufheizung von 3 min. Extra langes kabel ca. Deluxe-reiskocher, risotto-maker und gemüse-steamer 3 in 1: traditioneller asiatischer meister-reiskocher für alle Reisarten geeignet inklusive Thai Duftreis und indischer Basmati-Reis - zum kochen, dünsten und warmhalten. 500 x 14-in-1 / all in one spülmaschinentabs in normaler und nicht wasserlöslicher Folie.

Hochwertiger doppelt antihaftbeschichteter Innentopf. 2011 des "etm Testmagazins".

Weitere Informationen über Teekanne Tealounge

Ähnliche Produkte